PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00019.1.g01270.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 577aa    MW: 62296.5 Da    PI: 6.7391
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00019.1.g01270.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS147.21.6e-45298555110355
                          GRAS 110 ervHiiDfdisqGlQWpaLlqaLasRpeg..ppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrled 188
                                   +rvH +D+d  +G+QW++L+qa+ sRp++  +p+lR+T+v+++  g + +++e+g+ La f +++g pf+f     ++ + 
  Zjn_sc00019.1.g01270.1.am.mk 298 RRVHFVDYDSAEGVQWVSLMQAMISRPDSvlSPHLRVTAVSRSGGGVAWAVQEVGRHLAAFVASIGQPFSFGQCRLDSKDR 378
                                   89*************************55459**********7777***************************9999**** PP

                          GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh.nse..........sFlerfl 258
                                   +++ + r+ +g al+ n+vl+          ++    +++  + +l +k+v+vve++    ++e           Fl+ f+
  Zjn_sc00019.1.g01270.1.am.mk 379 FRPATVRMVKGGALIANCVLNQAAATTTFKRSAGSVVSFMAGMATLTAKLVTVVEEDQGDaEKEdgeggdaaagGFLAWFM 459
                                   ********************887777555555557888******************954424336688999999******* PP

                          GRAS 259 ealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakl 339
                                   + l+ ysa+ dslea++p++s+ r  vEr++l+++i + v+ + ++   + +  + W e+++  GF ++++s ++ +qa++
  Zjn_sc00019.1.g01270.1.am.mk 460 QELHRYSAVCDSLEAGFPTQSRVRGLVERVILAPNIASTVSRAYRAVDGDDKARGGWGEWMRGNGFWAMQFSCFNHSQARM 540
                                   ********************************************************************************* PP

                          GRAS 340 llrkvksdgyrveees 355
                                   ll  ++++ y++ee s
  Zjn_sc00019.1.g01270.1.am.mk 541 LLGLFNDR-YTMEEMS 555
                                   ******66.***9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098523.349289555IPR005202Transcription factor GRAS
PfamPF035145.5E-43298555IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 577 aa     Download sequence    Send to blast
LAESPTRVFL AHLELLLLDP NPGSGCREKS CASSGRAQHA WAHANRGAAR MVQCGCGIDD  60
SGMVAQIRKQ AAATRSLPPP HRSFSPVPTR QNTSGFQTKA QSQYKDRNQA SAMDVTMDDV  120
AGELKFSVCS SNTTSCSHDI WNIGLSPVAD WGLFCPDDGG QDLHGLIESM LWDSTLGGAA  180
VDDHAGLHPM FFCDEACCYT NGSAPSGTTT MKVDTPVYDF DVQGDCLEKA LRLLHLLMAA  240
AEALYGMHKS RELARVVLGL LKEIVSHTRA MNTAAFNMDR LAAHFTDALQ GRLDGCDRRV  300
HFVDYDSAEG VQWVSLMQAM ISRPDSVLSP HLRVTAVSRS GGGVAWAVQE VGRHLAAFVA  360
SIGQPFSFGQ CRLDSKDRFR PATVRMVKGG ALIANCVLNQ AAATTTFKRS AGSVVSFMAG  420
MATLTAKLVT VVEEDQGDAE KEDGEGGDAA AGGFLAWFMQ ELHRYSAVCD SLEAGFPTQS  480
RVRGLVERVI LAPNIASTVS RAYRAVDGDD KARGGWGEWM RGNGFWAMQF SCFNHSQARM  540
LLGLFNDRYT MEEMSPNNCR VSRSCAGASS LLARPPM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008653941.10.0PREDICTED: nodulation-signaling pathway 2 protein-like
TrEMBLA0A060CZR10.0A0A060CZR1_MAIZE; GRAS transcription factor (Fragment)
STRINGGRMZM2G055263_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75803148
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08250.16e-62GRAS family protein